Hello,
I would like to use SPN_bLactam_XX-DB for our analysis. Today, I found a duplicated PBP1A sequence.
In the amino acid sequence of Streptococcus pneumoniae PBP1A, types 1A_142 and 1A_131 have the same sequence. Which is the true type?
142||SPN_1A
SMKPITDYAPALEYGVYDSTASIVHDVPYNYPGTDTPLYNWDHVYFGNITIQYALQQSRNVTAVETLNKVGLDRAKTFLNGLGIDYPSMHYANAISSNTTESNKKYGASSEKMAAAYAAFANGGIYHKPMYINKIVFSDGSEKEFSDAGTRAMKETTAYMMTEMMKTVLTYGTGRGAYLPWLPQAGKTGTSNYTDEEIEKYIKNTGYVAPDEMFVGYTRKYSMAVWTGYSNRLTPIVGDGFLVAAKVYRSMITYLSEDTHPEDWTMPDGLFRNGEF
131||SPN_1A
SMKPITDYAPALEYGVYDSTASIVHDVPYNYPGTDTPLYNWDHVYFGNITIQYALQQSRNVTAVETLNKVGLDRAKTFLNGLGIDYPSMHYANAISSNTTESNKKYGASSEKMAAAYAAFANGGIYHKPMYINKIVFSDGSEKEFSDAGTRAMKETTAYMMTEMMKTVLTYGTGRGAYLPWLPQAGKTGTSNYTDEEIEKYIKNTGYVAPDEMFVGYTRKYSMAVWTGYSNRLTPIVGDGFLVAAKVYRSMITYLSEDTHPEDWTMPDGLFRNGEF
And even if other types have the same problem, I did not search for them. I just found this.
Thank you.
Hello,
I would like to use SPN_bLactam_XX-DB for our analysis. Today, I found a duplicated PBP1A sequence.
In the amino acid sequence of Streptococcus pneumoniae PBP1A, types 1A_142 and 1A_131 have the same sequence. Which is the true type?
And even if other types have the same problem, I did not search for them. I just found this.
Thank you.